<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_788 TH_788 Thailand 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ NVP+ 3TC 78

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   G190A   V35T, T39K, K43Q, E44D, K122E, D123S, I135T, K173I, Q174K, D177E, I178M, I202V, Q207A, R211K, V245E  
>TH_788| codons 17-257
DGPKVKQWPLTEEKIKALTEICKELEQDGKISKIGPENPYNTPVFAIKKKDSTKWRKLVD
FRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTN
NETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVIYQYMDDLYVASDLEIG
QHRTKVEELRAHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTVND
I

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005