<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_756 TH_756 Thailand 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ DDI 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     V35T, T39K, K43E, D121H, K122E, D123S, I135T, K173I, Q174K, D177E, Q207A, R211S, K238R, V245E, E248D  
>TH_756| codons 23-252
QWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNK
RTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLHESFRKYTAFTIPSTNNETPGI
RYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVIYQYVDDLYVGSDLEIGQHRTKI
EELRAHLLSWGFTTPDQKHQKEPPFLWMGYELHPDRWTVQPIELPDKDSW

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005