<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_720 TH_720 Thailand 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ NVP 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70E, V75T, Q151M A62V K101E, Y181C, G190A V108I A33V, V35T, T39K, E40K, K43E, V90I, V118C, K122E, D123S, K166R, Q174N, D177E, I178M, T200I, Q207D, L228H, K238R, V245E S191C
>TH_720| codons 17-257
DGPKVKQWPLTEEKIKVLTEICKKMEEEGKISKIGPENPYNTPVFVIKKKNSTEWRKLTD
FRELNKRTQDFWEIQLGIPHPAGLEKKKSVTILDVGDAYFSCPLDESFRKYTAFTIPSIN
NETPGIRYQYNVLPMGWKGSPAIFQSSMTRILEPFRKNNPEMVICQYMDDLYVACDLEIG
QHRIKIEELRDHLLRWGFTTPDKKHQKEPPFHWMGYELHPDRWTVQPIELPEKDSWTVND
I

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005