<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_700 TH_700 Thailand 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ EFV+ 3TC 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, T215Y   K101P, K103N   V35T, T39K, K43E, K122E, D123S, S162N, K173I, Q174K, D177E, T200I, Q207A, R211S, K238R, V245E  
>TH_700| codons 18-255
GPKVKQWPLTEEKIKALTEICKELEEEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDF
RELNKRTQDFWEVQLGIPHPAGLPKNKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINN
ETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRIKNPEIVIYQYVDDLYVGSDLEIGQ
HRIKIEELRAHLLSWGFYTPDKKHQKEPPFLWMGYELHPDRWTVQPIELPEKDSWTVN

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005