<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_693 TH_693 Thailand 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y D67E     V35T, T39K, K43E, E44A, S68G, K102Q, K122E, D123N, K173I, Q174K, I178M, T200A, Q207A, R211N, K238R, V245E  
>TH_693| codons 17-255
DGPKVKQWPLTEEKIKALTEICKELEEAGKISKIGPENPYNTPVFAIKKKEGTKWRKLVD
FRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSIN
NETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPDMVIYQYMDDLYVGSDLEIG
QHRAKIEELRAHLWNWGFYTPDKKHQKEPPFLWMGYELHPDRWTVQPIELPEKDSWTVN

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005