<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_671 TH_671 Thailand 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC+ NVP 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q G190A K101H V35T, T39K, K43E, V60I, K122E, D123S, I135T, K173I, Q174K, D177E, I178M, T200I, Q207A, R211S, V245E Q91H
>TH_671| codons 17-258
DGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPIFAIKKKNSTRWRKLVD
FRELNKRTQDFWEVHLGIPHPAGLHKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTN
NETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVIYQYVDDLYVASDLEIG
QHRIKIEELRAHLLSWGFFTPDQKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTVND
IQ

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005