<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_654 TH_654 Thailand 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 EFV+ AZT+ 3TC 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V, T215F   K101E, K103N, G190A   E28A, V35T, T39E, K122E, D123S, K173T, Q174K, D177E, I178M, G196E, Q207A, R211H, K238R, V245E  
>TH_654| codons 18-249
GPKVKQWPLTAEKIKALTEICEEMEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDF
RELNKRTQDFWEVQLGIPHPAGLEKNKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINN
ETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEMVIYQYVDDLYVASDLEIEQ
HRTKIEELRAHLLHWGFFTPDKKHQKEPPFLWMGYELHPDRWTVQPIELPEK

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005