<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_647 TH_647 Thailand 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ NVP 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219E Y181C   V35T, E36D, T39K, K43E, V106I, K122E, D123N, I135T, K173T, Q174K, I202V, Q207A, L210M, K238R, V245E  
>TH_647| codons 18-249
GPKVKQWPLTEEKIKALTDICKEMEEEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDF
RELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPLDENFRKYTAFTIPSTNN
ETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVICQYVDDLYVGSDLEIGQ
HRTKVEELRAHLMRWGFTTPDEKHQKEPPFLWMGYELHPDRWTVQPIELPEK

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005