<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_575 TH_575 Thailand 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, T215F K219Q   V179D V35L, V60I, K102E, K122E, I135V, E138A, T139A, D177E, I202V, V245K  
>TH_575| codons 21-256
VKQWPLTEEKIKALLEICTELEKEGKISKIGPENPYNTPIFAIKKKNSDRWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKEKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNAAP
GIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIDIYQYMDDLYVGSDLEIGQHRT
KVEELRQHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWTVQPIKLPEKDSWTVND

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005