<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_557 TH_557 Thailand 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 EFV+ D4T+ DDI 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T215F   K101E, G190S   K166R, I202V, Q207E, R211K  
>TH_557| codons 17-228
DGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVD
FRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSIN
NETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVIYQYMDDLYVSSDLEIG
QHRTKVEELREHLLKWGFFTPDKKHQKEPPFL

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005