<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_549 TH_549 Thailand 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ 3TC+ AZT 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y   K101E, G190A, P236L K238T V35I, T39P, K43E, K102R, V118I, I135V, I142V, S162C, V189I, R211K, V245E  
>TH_549| codons 20-252
KVKQWPLTEEKIKALIEICPELEEEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLERKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSVNNET
PGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYVDDLYIASDLEIGQHR
TKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHLDTWTVQPIELPEKDSW

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005