<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_540 TH_540 Thailand 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ D4T+ NVP 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R   Y181C, P236L   V106I, E169D, V179A, G196E, E203K, Q207H, H221Y, V245E  
>TH_540| codons 21-250
VKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETP
GIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIAICQYMDDLYVGSDLEIEQHRT
KIKELRHHLLRWGFTTPDKKYQKEPPFLWMGYELHLDKWTVQPIELPEKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005