<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_534 TH_534 Thailand 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ D4T 78

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y       V35T, T39K, K43E, V60I, S68G, W88C, K122E, D123S, I135T, K173I, Q174K, D177E, V189I, Q207A, R211S, V245E D186E
>TH_534| codons 18-247
GPKVKQWPLTEEKIKALTEICKELEEEGKISKIGPENPYNTPIFAIKKKDGTKWRKLVDF
RELNKRTQDFCEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNN
ETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVIYQYMDELYIGSDLEIGQ
HRTKIEELRAHLLSWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005