<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_533 TH_533 Thailand 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 208

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       K43Q, V60I, D123E, I135V, S162C, I178M, V179I, L205V, R211K, K223Q, L228R, V245K I167M
>TH_533| codons 18-255
GPKVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDF
RELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSVNN
ETPGIRYQYNVLPQGWKGSPAIFQCSMTKMLEPFRKQNPDMIIYQYMDDLYVGSDLEIGQ
HRTKIEEVRQHLWKWGFYTPDKKHQQEPPFRWMGYELHPDKWTVQPIKLPEKDSWTVN

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005