<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_502 TH_502 Thailand 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ NVP+ 3TC 36

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75T, T215Y   Y181C, G190A   M16V, K32R, V35T, T39K, K43E, K122E, D123S, K173I, Q174K, D177E, I178M, V179I, G196E, Q207A, R211N, K238R, V245E E248Y
>TH_502| codons 16-255
VDGPKVKQWPLTEEKIRALTEICKELEEEGKISKIGPENPYNTPVFAIKKKNSTKWRKLT
DFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSI
NNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMIICQYMDDLYVASDLEI
EQHRTKIEELRAHLLNWGFYTPDKKHQKEPPFLWMGYELHPDRWTVQPIELPYKDSWTVN

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005