<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_458 TH_458 Thailand 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 156
2 3TC+ EFV+ D4T 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Q151M, T215F D67T, T69G, F116Y, K219E G190A   V35T, T39K, K43A, V60I, K122E, D123S, S162C, S163A, K173I, Q174K, D177E, T200A, I202T, Q207A, R211S, K238R, V245E  
>TH_458| codons 17-256
DGPKVKQWPLTEEKIKALTEICKEMEAEGKISKIGPENPYNTPIFAIKRKTSGRWRKLVD
FRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPLDESFRKYTAFTIPSIN
NETPGIRYQYNVLPMGWKGSPAIFQCAMTKILEPFRIKNPEIVIYQYMDDLYVASDLEIG
QHRAKTEELRAHLLSWGFFTPDEKHQKEPPFLWMGYELHPDRWTVQPIELPEKDSWTVND

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005