<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_454 TH_454 Thailand 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ NVP+ D4T 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y K219N Y181C K238T T39E, E44D, A98S, V118I, G196E, H208F, R211K, L228R N136T
>TH_454| codons 19-254
PKVKQWPLTEEKIKALVEICEELEKDGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFR
ELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSITNE
TPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIEQH
RTKIEELRQFLWKWGFYTPDNKHQKEPPFRWMGYELHPDTWTVQPIVLPEKDSWTV

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005