<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_449 TH_449 Thailand 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ NVP+ AZT 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y181C V179D V35T, T39K, K43Q, K102Q, K122E, D123S, A158T, K173I, Q174K, D177E, I178V, T200I, I202V, Q207A, R211S, V245E N136T
>TH_449| codons 16-254
MDGPKVKQWPLTEEKIKALTEICKEMEQEGKISKIGPENPYNTPVFAIKKKDSTKWRKLV
DFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSI
TNETPGIRYQYNVLPQGWKGSPTIFQSSMTKILEPFRIKNPEVDICQYVDDLYVGSDLEI
GQHRIKVEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTV

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005