<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TH_432 TH_432 Thailand 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI| NFV| LPV| D4T| EFV 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y   K103N, M230L   V35L, T39S, E44D, K64H, V118I, D123E, I178M, T200A, V245E  
>TH_432| codons 17-255
DGPKVKQWPLTEEKIKALLEICSELEKDGKISKIGPENPYNTPVFAIHKKNSDKWRKLVD
FRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSIN
NETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVIYQYMDDLYVGSDLEIG
QHRAKIEELRQHLWRWGFYTPDKKHQKEPPFLWLGYELHPDKWTVQPIELPEKDSWTVN

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005