<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patMOU_2 00_MOU_2 France 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT| DDC| D4T| ABC| DDI| EFV| IDV| NFV| RTV| SQV 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A, I84V   L10I, I13V, G17E, K20I, M36I, D60E, I62V, L63P, A71T  
>00_MOU_2| codons 1-99
PQITLWQRPIVTVKIGEQLIEALLDTGADDTVLEEINLPGRWKPKMIVGIGGFVKVRQYE
QVPIEICGHKTIGTVLVGPTPANVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74V, M184V T215V, K219Q L100I, K103N   K20R, K66X, I135V, V179I, I202V, F214L, L228H K13M
>00_MOU_2| codons 1-246
PISPIETVPVKLMPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKTNSTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGLVTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVL

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005