<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AC_Pat42 RO.00.IS.42 Romania 2000 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 25
2 None NA
3 AZT+ NVP+ IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12S, I15V, L19V, K20R, E35D, M36I, R41K, R57K, I62V, L63T, L89M, I93L  
>RO.00.IS.42| codons 1-99
PQITLWQRPVVSIKVGGQVREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QVTIEICGHKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Apetrei, C HIV type 1 diversity in northeastern Romania in 2000-2001 based on phylogenetic analysis of pol sequences from patients failing antiretroviral therapy. ARHR, 2003