<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AC_Pat37 RO.00.IS.37 Romania 2000 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC+ AZT NA
2 None NA
3 NVP+ RTV+ D4T NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10V, T12S, I15V, L19I, K20T, E35D, M36I, R41K, R57K, I62V, L63T, E65D, T74S, L89M  
>RO.00.IS.37| codons 1-99
PQITLWQRPVVSIKVGGQITEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QVTIDICGHKAIGSVLVGPTPVNIIGRNMMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35P, T39A, E40D, K49R, D123E, I135L, S162H, K173A, Q174K, P176Q, D177E, I195L, T200A, Q207T, R211K  
>RO.00.IS.37| codons 33-239
ALPEICADMEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQL
GIPHPAGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSLNNETPGIRYQYNVLPQG
WKGSPAIFQHSMTKILEPFRAKNQEIVIYQYMDDLYVGSDLELGQHRAKIEELRTHLLKW
GFTTPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Apetrei, C HIV type 1 diversity in northeastern Romania in 2000-2001 based on phylogenetic analysis of pol sequences from patients failing antiretroviral therapy. ARHR, 2003