<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AC_Pat26 RO.00.IS.26 Romania 2000 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC+ AZT NA
2 None NA
3 IDV+ EFV+ D4T NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R K219Q Y188L V179D V35T, T39A, V60I, K103R, D123E, I135L, S162H, K173T, Q174K, I195L, Q207V, H208Y, R211K  
>RO.00.IS.26| codons 33-239
ALTEICAEMEKEGKISKIGPENPYNTPIFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQL
GIPHPAGLKKRKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSLNNETPGIRYQYNVLPQG
WKGSPAIFQHSMTKILEPFRTKNPDIDIYQYMDDLLVGSDLELGQHRTKIEELRVYLLKW
GFTTPDQKHQKEPPFLWMGYELHPDKW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, E35D, M36I, R41K, R57K, L63T, E65D, I72V, T74S, L89M  
>RO.00.IS.26| codons 1-99
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QITIDICGHKAVGSVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Apetrei, C HIV type 1 diversity in northeastern Romania in 2000-2001 based on phylogenetic analysis of pol sequences from patients failing antiretroviral therapy. ARHR, 2003