<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AC_Pat23 RO.01.IS.23 Romania 2001 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC+ AZT NA
2 None NA
3 IDV+ NVP+ AZT NA
4 NFV+ DDI+ SQV+ 3TC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R K219Q K103N, Y181C   V35T, T39A, E40D, V60I, V90I, D123E, I135L, T139S, S162H, K173A, Q174K, I195L, G196E, Q197K, T200E, E203D, Q207E, R211K, E224D, L228H  
>RO.01.IS.23| codons 33-239
ALTEICADMEKEGKISKIGPENPYNTPIFAIKKKNSDRWRKLVDFRELNKRTQDFWEIQL
GIPHPAGLKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSLNNESPGIRYQYNVLPQG
WKGSPAIFQHSMTKILEPFRAKNPDIVICQYMDDLYVGSDLELEKHREKIDELREHLLKW
GFTTPDQKHQKDPPFHWMGYELHPDKW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A   L10V, I15V, G16E, K20R, E35D, M36I, R41K, K45R, R57K, L63T, E65D, I72T, L89M  
>RO.01.IS.23| codons 1-99
PQITLWQRPVVTIKVEGQLREALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QITIDICGHKATGTVLVGPTPANIIGRNMLTQIGCTLNF

References
Author Title Citation
Apetrei, C HIV type 1 diversity in northeastern Romania in 2000-2001 based on phylogenetic analysis of pol sequences from patients failing antiretroviral therapy. ARHR, 2003