<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AC_Pat20 RO.01.IS.20 Romania 2001 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC+ AZT NA
2 None NA
3 IDV+ EFV+ D4T NA
4 RTV+ IDV+ 3TC NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16E, K20R, E35D, M36I, R41K, R57K, L63T, E65D, I72T, L89M  
>RO.01.IS.20| codons 1-99
PQITLWQRPLVTIKVEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QITIDICGHKATGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N P225H V35T, T39A, E40D, D123E, I135L, S162H, K173A, Q174K, T200A, Q207A, R211K  
>RO.01.IS.20| codons 33-239
ALTEICADMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQL
GIPHPAGLKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSLNNETPGIRYQYNVLPQG
WKGSPAIFQHSMTKILEPFRAKNPDIVIYQYMDDLYVGSDLEIGQHRAKIEELRAHLLKW
GFTTPDKKHQKEHPFLWMGYELHPDKW

References
Author Title Citation
Apetrei, C HIV type 1 diversity in northeastern Romania in 2000-2001 based on phylogenetic analysis of pol sequences from patients failing antiretroviral therapy. ARHR, 2003