<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AC_Pat1 RO.01.IS.01 Romania 2001 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC+ AZT NA
2 Unknown NA
3 NFV+ SQV+ D4T NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, I84V L24I, K43T, G48W, F53L L10I, I15V, G16E, K20R, E35D, M36I, R41K, R57K, L63T, E65D, I72T, L89M  
>RO.01.IS.01| codons 1-99
PQITLWQRPIVTIKVEGQLREALIDTGADDTVLEDINLPGKWTPKIIWGIGGLVKVKQYD
QITIDICGHKATGTVLVGPTPANVIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W T69G, T215C L100I, K103N   V35T, T39A, E44D, D123E, I135L, I142T, S162H, K173T, Q174K, I195L, T200A, E203K, Q207A, H208Y, R211E, K223Q, L228R  
>RO.01.IS.01| codons 33-239
ALTEICAELEKDGKISKIGPENPYNTPVFAIKKKDSGKWRKLVDFRELNKRTQDFWEVQL
GIPHPAGIKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSLNNETPGTRYQYNVLPQG
WKGSPAIFQHSMTKILEPFRTKNPDIVIYQYMDDLYVGSDLELGQHRAKIKELRAYLWEW
GFCTPDKKHQQEPPFRWMGYELHPDKW

References
Author Title Citation
Apetrei, C HIV type 1 diversity in northeastern Romania in 2000-2001 based on phylogenetic analysis of pol sequences from patients failing antiretroviral therapy. ARHR, 2003