<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AC_Pat1 RO.00.IS.01 Romania 2000 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC+ AZT NA
2 Unknown NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I, K43T L10I, I15V, G16E, K20R, E35D, M36I, R41K, R57K, L63T, E65D, I72T, L89M  
>RO.00.IS.01| codons 1-99
PQITLWQRPIVTIKVEGQLREALIDTGADDTVLEDINLPGKWTPKIIGGIGGFVKVKQYD
QITIDICGHKATGTVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L74V, M184V, L210W T215C L100I, K103N   V35T, T39A, E44D, D123E, I135L, I142T, S162H, K173T, Q174K, I195L, T200A, E203K, Q207A, H208Y, R211E, K223Q, L228R  
>RO.00.IS.01| codons 33-239
ALTEICAELEKDGKISKIGPENPYNTPVFAIKKKDSDKWRKVVDFRELNKRTQDFWEVQL
GIPHPAGIKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSLNNETPGTRYQYNVLPQG
WKGSPAIFQHSMTKILEPFRTKNPDIVIYQYVDDLYVGSDLELGQHRAKIKELRAYLWEW
GFCTPDKKHQQEPPFRWMGYELHPDKW

References
Author Title Citation
Apetrei, C HIV type 1 diversity in northeastern Romania in 2000-2001 based on phylogenetic analysis of pol sequences from patients failing antiretroviral therapy. ARHR, 2003