<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patROUG 01_ROUG729 France 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 126
2 AZT+ DDI 4
3 DDI 4
4 None 313
5 3TC+ ABC+ AZT+ NFV 52
6 3TC+ ABC+ AZT+ NVP 69
7 Unknown 31

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   K103N, Y181C   K20R, K43E, E44A, K49R, D121Y, K122E, I135T, D177E, T200I, E204K, R211Q, L228R  
>01_ROUG729| codons 1-239
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEEAGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYMDDLYVGSDLEIGQHRIKIEKLRQHLWQWGFYTPDKKHQKEPPFRWMGYELHPDKW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73T L10I, D60E, Q61E, I62V, L63P, I64V, I66L, I93L  
>01_ROUG729| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYE
EVPVELCGHKAITTVLVGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005