<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patKAF 01_KAF715 France 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 221
2 EFV+ AZT+ 3TC 45

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V, T215F K219Q K101E, V106M   V35T, E36D, T39R, K43E, V60I, K122E, D123N, I135T, A158S, S162A, K173T, Q174K, N175Y, D177E, T200A, I202V, Q207E  
>01_KAF715| codons 1-244
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICREMEEEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSMTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPSIFQASMTKILEPFRTKYPEIVI
YQYVDDLYVGSDLEIGQHRAKVEELREHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, K14R, K20I, M36I, R41K, L63P, H69K, K70T, L89M  
>01_KAF715| codons 1-99
PQITLWQRPLVTARIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKTAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004