<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patLEF C 01_LEF803 France 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 SQV| RTV| NVP| NFV| DDI| D4T| AZT| ABC| 3TC 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, L210W, T215Y K219E Y181C   V35I, D121Y, K122E, D177E, H221Y  
>01_LEF803| codons 1-239
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYVDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTPDEKYQKEPPFLWMGYELHPDKW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A, L90M   L10I, L19I, N37S, F53I, I62V, L63P, H69Q  
>01_LEF803| codons 1-99
PQITLWQRPIVTIKIGGQIKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGIIKVRQYD
QVPIEICGQKAIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005