<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patPIE 02_PIE716 France 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ AZT+ 3TC 72

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, V60I, D121H, K122E, D123G, I135T, Y144F, K173L, Q174K, D177E, V179I, T200A, Q207A, R211S  
>02_PIE716| codons 28-239
EEKIKALTEICTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDF
WEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLHEGFRKYTAFTIPSTNNETPGIRFQYN
VLPQGWKGSPAIFQSSMTKILEPFRLKNPEIIIYQYMDDLYVGSDLEIGQHRAKIEELRA
HLLSWGFTTPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004