<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patLEV 00_LEV709 France 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 39
2 D4T+ 3TC 52
3 IDV+ DDC+ AZT 25
4 IDV+ DDC+ AZT+ 3TC 43
5 NFV+ DDI+ DDC+ D4T 8
6 NFV+ DDI+ D4T 4
7 SQV+ NFV+ DDI 45

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54V, V82A, L90M F53L L10I, I13V, K20R, M36I, R41K, L63P, C67S, A71V  
>00_LEV709| codons 1-99
PQITLWQRPIVTVKIGGQLREALLDTGADDTILEEINLPGKWKPKIIGGIGGLVKVRQYD
QIPIEISGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       K20R, K43E, E44D, V60I, V118I, K122E, I135V, R211K  
>00_LEV709| codons 1-242
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEEDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005