<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patFOR 02_FOR713 France 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC+ SQV 15
2 3TC+ D4T+ SQV 13
3 3TC+ D4T+ RTV 10
4 D4T+ DDI+ RTV+ SQV 10
5 AZT+ D4T+ RTV+ SQV 1
6 3TC+ AZT+ IDV 15
7 3TC+ D4T+ DDI 14
8 3TC+ D4T+ DDI+ NVP 1
9 D4T+ DDI+ NFV+ NVP 14
10 3TC+ D4T+ NFV+ NVP 12
11 D4T+ NFV+ NVP 7
12 None 3
13 ABC+ RTV+ SQV 22
14 ABC+ APV+ DDC 7
15 ABC+ DDC 19
16 ABC+ DDC+ IDV+ RTV 3
17 ABC+ DDI+ IDV+ RTV 47
18 None 25
19 3TC+ ABC+ DDI+ LPV 45
20 None 18
21 3TC+ ABC+ AZT+ LPV 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, T215Y       K101Q, K122E, I135T, S162C, L210F, D218E, K219T, L228N  
>02_FOR713| codons 1-241
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLFRWGFYTPETKHQKEPPFNWMGYELHPDKWT
V

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M G73S L10I, I13V, Q18H, K20M, E35D, M36I, N37H, I62V, L63P, A71T, I72V  
>02_FOR713| codons 1-99
PQITLWQRPIVTVKIGGHLMEALLDTGADDTVLEDIHLPGRWKPKIIGGIGGFVKVRQYD
QVPIEICGHKTVSTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005