Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| MB_patFOR | 02_FOR713 | France | 2002 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+ DDC+ SQV | 15 |
| 2 | 3TC+ D4T+ SQV | 13 |
| 3 | 3TC+ D4T+ RTV | 10 |
| 4 | D4T+ DDI+ RTV+ SQV | 10 |
| 5 | AZT+ D4T+ RTV+ SQV | 1 |
| 6 | 3TC+ AZT+ IDV | 15 |
| 7 | 3TC+ D4T+ DDI | 14 |
| 8 | 3TC+ D4T+ DDI+ NVP | 1 |
| 9 | D4T+ DDI+ NFV+ NVP | 14 |
| 10 | 3TC+ D4T+ NFV+ NVP | 12 |
| 11 | D4T+ NFV+ NVP | 7 |
| 12 | None | 3 |
| 13 | ABC+ RTV+ SQV | 22 |
| 14 | ABC+ APV+ DDC | 7 |
| 15 | ABC+ DDC | 19 |
| 16 | ABC+ DDC+ IDV+ RTV | 3 |
| 17 | ABC+ DDI+ IDV+ RTV | 47 |
| 18 | None | 25 |
| 19 | 3TC+ ABC+ DDI+ LPV | 45 |
| 20 | None | 18 |
| 21 | 3TC+ ABC+ AZT+ LPV | 16 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46I, I54V, I84V, L90M | G73S | L10I, I13V, Q18H, K20M, E35D, M36I, N37H, I62V, L63P, A71T, I72V |
| >02_FOR713| codons 1-99 PQITLWQRPIVTVKIGGHLMEALLDTGADDTVLEDIHLPGRWKPKIIGGIGGFVKVRQYD QVPIEICGHKTVSTVLVGPTPVNVIGRNLMTQIGCTLNF |
RT Sequence
| NRTIMajorDRMs | NRTIMinorDRMs | NNRTIMajorDRMs | NNRTIMinorDRMs | Polys | UnusualMuts |
| M41L, D67N, L74V, M184V, T215Y | K101Q, K122E, I135T, S162C, L210F, D218E, K219T, L228N |
| >02_FOR713| codons 1-241 PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI YQYVDDLYVGSDLEIGQHRTKIEELRQHLFRWGFYTPETKHQKEPPFNWMGYELHPDKWT V |
References
| Author | Title | Citation |
| Montes, B | Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. | JAIDS, 2004 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |