<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patPIA 01_PIA731 France 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT 117
2 DDI 69
3 DDI+ 3TC 17
4 D4T+ 3TC 43
5 IDV+ D4T 17
6 NVP+ D4T+ 3TC 13
7 NFV+ D4T+ 3TC 30
8 SQV+ DDI+ D4T 21
9 SQV+ RTV+ DDI+ D4T 17
10 SQV+ RTV+ EFV+ DDI 17
11 NVP+ DDI+ D4T 26
12 DDI+ 3TC 21
13 DDI+ ABC 4
14 None 4
15 DDI+ APV 11

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20M, R41K, H69Y  
>01_PIA731| codons 1-99
PQITLWQRPLVTIKIGGQLMEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGYKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   L100I, K103N   T27P, V35T, E36A, K122E, I135T, S162A, K173T, Q174K, D177E, T200A, Q207E, H221Y  
>01_PIA731| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLPEEKIKALTAICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLWRWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004