<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patAVO 01_AVO720 France 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NFV| DDC| D4T| AZT| 3TC 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   L10V, L63P, I64V, I72V, V77I, I93L T74R
>01_AVO720| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPVEICGHKAVGRVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184I, L210W A62V, T215S   A98G R83K, I135V, S162C, T165V, I202V  
>01_AVO720| codons 1-240
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMVKILEPFRKQNPDIVI
YQYIDDLYVGSDLEIGQHRTKVEELRQHLWRWGFSTPDKKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005