<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patCAS 00_CASE717 France 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 113
2 3TC+ AZT+ DDC+ SQV 30
3 3TC+ D4T+ RTV 30
4 D4T+ DDI+ SQV 34
5 AZT+ DDI+ NFV+ SQV 21
6 3TC+ AZT+ DDI+ NFV+ SQV 34
7 ABC+ DDI+ NFV+ SQV 40

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A, L90M K43T L10I, R41K, L63P, A71V, I72V, V77I, I93L  
>00_CASE717| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWTPKMIVGIGGFVKVRQYD
QIPIEICGHKVVGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, L210W, T215Y   K103N   E6D, T39K, K43E, E44D, V60I, V118I, K122P, D123E, I135T, S162N, K173T, D177E, G196D, E203K, Q207E, H208Y, R211K, K223Q  
>00_CASE717| codons 1-242
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICKELEEDGKISKIGPENPYNTPI
FAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DPEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRTQNPEIVI
YQYMDDLYVGSDLEIDQHRTKIKELREYLWKWGFYTPDKKHQQEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005