<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patPAL 99_PAL710 France 1999 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT 156
2 None 91
3 DDI+ AZT 21
4 SQV+ DDI+ AZT 34
5 SQV+ AZT+ 3TC 30
6 SQV+ RTV+ D4T 43
7 NVP+ NFV+ DDI+ D4T 23

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y V75M K103N, Y181C   V35T, K43A, E44D, K49R, V60I, T107S, K122E, I142V, S162D, Q174N, D177E, T200A, Q207N, R211K K32H
>99_PAL710| codons 1-243
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIHALTEICTELEADGKISRIGPENPYNTPI
FAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVSVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKNNPEIVI
CQYMDDLYVGSDLEIGQHRAKIEELRNHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46L, L90M L33I, N88D, L89V I13V, K20I, M36I, L63P, C67S, H69K, A71V  
>99_PAL710| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADNTVIEEINLPGRWKPKLIGGIGGFIKVRQYD
QIPIEISGKKVIGTVLVGPTPVNIIGRDVMTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004