<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patLEC 01_LECS714 France 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 160
2 DDI 26
3 SQV+ DDI+ D4T 13
4 IDV+ AZT+ 3TC 213
5 NVP+ NFV+ DDI 82
6 None 8
7 SQV+ RTV+ AZT+ 3TC 39
8 LPV+ AZT+ 3TC 21
9 LPV+ ABC+ 3TC 20

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219Q   A98G P4S, V118I, D123E, S162D, K166R, D177E, V179I, I202V, R211K, F214L, L228H  
>01_LECS714| codons 1-240
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQDSMTRILEPFRKQNPEIII
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGLFTPDQKHQKEPPFHWMGYELHPDKWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82S, L90M K43T L10I, Q18H, L19I, N37S, Q61N, I62V, I64V, A71T, I72V, T74S, V77I, I93L  
>01_LECS714| codons 1-99
PQITLWQRPIVTIKIGGHIKEALLDTGADDTVLEEMSLPGRWTPKMIVGIGGFVKVRQYD
NVLVEICGHKTVGSVLIGPTPSNIIGRNLMTQLGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005