<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patKON 00_KON723 France 2000 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT 39
2 DDI+ AZT 4
3 IDV+ D4T+ 3TC 52
4 NFV+ D4T+ 3TC 65
5 NVP+ DDI+ D4T 30
6 NVP+ DDC+ D4T+ ABC 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215F   Y181C, G190A   V35T, E36A, T39K, K43E, D121H, K122E, D123S, I142V, S162F, K173S, Q174K, D177E, I178L, V179I, T200A, E203K, Q207D, H208Y, H221Y K223N
>00_KON723| codons 1-224
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICKELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQFSMTKILEPFRSKNPELII
CQYVDDLYVASDLEIGQHRAKIKELRDYLLRWGFFTPDKKYQNE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V   L10V, I13V, K14R, K20I, E35G, M36I, R41K, I64M, H69K, A71V, L89I  
>00_KON723| codons 1-99
PQITLWQRPVVTVRIGGQLIEALLDTGADDTVLEGINLPGKWKPKMIGGIGGFVKVRQYD
QILMEICGKKVIGTVLVGPTPVNIIGRNILTQIGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004