<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patCAST 00_CAST712 France 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC+ AZT 169
2 NVP+ DDI+ D4T 30

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215Y   V106A, Y181C, G190A   V35M, V60I, I135T, T200A, E204D, R211Q, D218E  
>00_CAST712| codons 17-239
DGPKVKQWPLTEEKIKALMEICTELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLVD
FRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPLDKDFRKYTAFTIPSTN
NETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVASDLEIG
QHRAKIEDLRQHLLQWGFYTPEKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005