<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patDER 02_DER736 France 2002 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 69
2 NFV+ D4T+ 3TC 47
3 NFV+ DDI+ AZT+ ABC+ 3TC 132

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D L10Y, I13V, E35D, M36I, I62V, L63P, I64V, T74S, V77I  
>02_DER736| codons 1-99
PQITLWQRPYVTVKIGGQLKEALLDTGADNTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QVPVEICGHKAIGSVLIGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K49R, V60I, K122E, D177E, Q207E, V245K, D250E  
>02_DER736| codons 1-251
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKES

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005