<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patDEP 01_DEP716 France 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 47
2 AZT+ 3TC 30
3 DDI+ D4T+ 3TC 87
4 NFV+ AZT+ 3TC 104
5 NFV+ AZT 27

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10F, N88D E35D, M36I, R57K, I62V, L63P, H69Q  
>01_DEP716| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADNTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
QVPIEICGQKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       K122E, D123N, I135L, S162C, I195L, L210F  
>01_DEP716| codons 1-245
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLELGQHRTKIEELRQHLFRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIV

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005