<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patMIL 01_MIL704 France 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 SQV| RTV| NVP| NFV| DDI| D4T| AZT| 3TC 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M F53L L10I, I13V, N37S, R41K, L63S, I64M, A71V, T74S, V77I, I93L  
>01_MIL704| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKIIGGIGGLIKVRQYD
QISMEICGHKVIGSVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   K103N   K20R, K43N, V118I, I135V, R211K  
>01_MIL704| codons 1-239
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005