<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patDEL 01_DEL725 France 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 156
2 NVP+ DDI+ AZT 8
3 NVP+ D4T+ 3TC 39
4 RTV+ IDV+ DDI+ ABC 21
5 AZT+ ABC+ 3TC 25

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35D, M36I, R41K, K45R, R57K, L63S, C67E, H69K, V82I, L89M  
>01_DEL725| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QISIEIEGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215Y K219E K103N   V35T, T39L, V60I, W88C, K101Q, V118I, K122E, D123S, I135T, E138A, K173T, Q174K, D177E, T200A, E203D, Q207D, R211K, F214L  
>01_DEL725| codons 1-242
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFCEVQLGIPHPAGLQKNKSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIDELRDHLLKWGLYTPDEKHQKEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004