<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patMAU 01_MAU717 France 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 42
2 AZT+DDI 205
3 D4T+DDI 34
4 3TC+D4T 55
5 3TC+D4T+SQV 90

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, E36A, T39D, S48T, V60I, D121Y, K122E, I135V, K173A, Q174K, D177E, T200A, Q207E, R211K  
>01_MAU717| codons 1-237
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36T, R41K, L63P, H69K, I72V, I93L  
>01_MAU717| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEETNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAVGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004