<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patCOU 02_COUL707 France 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 187
2 SQV+ DDI+ D4T 30
3 RTV+ D4T+ 3TC 21
4 IDV+ D4T+ 3TC 13
5 NFV+ IDV+ DDI 21
6 IDV+ EFV+ ABC 136
7 ABC 57

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S L10I, T12S, I15V, K20T, M36I, R41K, L63P, H69K, A71V, I93L  
>02_COUL707| codons 1-99
PQITLWQRPIVSIKVGGQLTEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKVISTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_VG, K70R       V35T, E36A, T39D, K122E, D123S, I135T, K173A, Q174K, D177E, T200A, Q207E, R211K  
>02_COUL707| codons 1-239
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKISKIGPENPYNTPV
FAIKKKDSSRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004