<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patMIC 01_MICA510 France 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 169
2 3TC+ D4T+ RTV 26
3 3TC+ D4T+ IDV 26
4 D4T+ DDI+ RTV+ SQV 30
5 D4T+ DDI+ NFV 4
6 NFV+ NVP+ SQV 17
7 ABC+ NFV 13
8 DDI 8
9 3TC+ D4T+ RTV+ SQV 17
10 3TC+ AZT+ DDI 21
11 3TC+ DDI+ SQV 17
12 3TC+ AZT+ SQV 21
13 3TC+ RTV+ SQV 4
14 3TC+ AZT+ SQV 4
15 3TC+ DDI+ LPV 26
16 3TC+ DDI 4
17 None 8
18 3TC+ APV+ DDI+ RTV 1

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M   L10I, K20R, E35D, M36I, N37D, I62V, L63P, A71V, T74S, V77I  
>01_MICA510| codons 1-98
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKLIGGIGGFVKVRQYD
QVPIEICGHKVIGSVLIGPTPANIIGRNLMTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184I, L210W, T215Y K219R K103N, Y181C   E44D, V118I, K122E, I142V, E203K, H208Y, R211K, K223Q V10E
>01_MICA510| codons 1-240
PISPIETVPEKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYIDDLYVGSDLEIGQHRTKIKELRQYLWKWGFYTPDRKHQQEPPFLWMGYELHPDKWT

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005