<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patCOR 01_CORN708 France 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC+ AZT 52
2 D4T+ 3TC 52
3 SQV+ RTV+ EFV+ D4T+ ABC+ 3TC 4
4 SQV+ RTV+ EFV+ ABC 56
5 None 8
6 LPV+ DDI+ 3TC 34
7 RTV+ DDI+ APV 17
8 DDI 4

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215F   Y181C, G190A A98G, V179D V35I, T39A, E40F, K43E, K103R, V118I, K122E, S162A, G196E, T200I, E203D, L205F, Q207E, H208Y, R211K, E224D, L228H  
>01_CORN708| codons 1-239
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAFLEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKRKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIDI
CQYMDDLYVASDLEIEQHRIKIDEFREYLWKWGFFTPDKKHQKDPPFHWMGYELHPDKW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I50V, I54T, V82A L33F L10I, E34Q, E35D, M36I, N37D, L63P, A71V, I93L  
>01_CORN708| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVFQDIDLPGRWKPKIIVGVGGFTKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005