<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MB_patCON 02_CON701 France 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 263

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       V35T, E36D, T39A, K43Q, I135V, S162A, K173A, Q174K, D177E, I195L, T200A, Q207E, R211K  
>02_CON701| codons 1-239
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICAELEQEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLELGQHRAKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, G17E, K20I, M36I, N37D, L63M, I64M, H69K, L89M  
>02_CON701| codons 1-98
PQITLWQRPIVTVRIGEQLIEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVRQYD
QIMMEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLN

References
Author Title Citation
Montes, B Comparison of drug resistance mutations and their interpretation in patients infected with non-B HIV-1 variants and matched patients infected with HIV-1 subtype B. JAIDS, 2004